Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries) Uniprot P10970 |
Domain d1qvfq_: 1qvf Q: [96379] Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1qvf (more details), 3.1 Å
SCOPe Domain Sequences for d1qvfq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvfq_ d.55.1.1 (Q:) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]} gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg eqqgrkpramgrasawnspqvdvelileep
Timeline for d1qvfq_:
View in 3D Domains from other chains: (mouse over for more information) d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ |