SCOPe 2.05: Domain d1qvfl_: 1qvf L:

Lineage for d1qvfl_ (1qvf L:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures
   automatically mapped to Pfam PF00827

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
   Uniprot P60618

8. Domain d1qvfl_: 1qvf L: [96374]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvfl_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (L:) L15 Ribosomal Protein

SCOPe Domain Sequences for d1qvfl_:

Sequence; same for both SEQRES and ATOM records:

>d1qvfl_ d.12.1.2 (L:) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

Timeline for d1qvfl_:

• d1qvfl_ first appeared in SCOP 1.67
  
• d1qvfl_ appears in SCOPe 2.04
  
• d1qvfl_ appears in SCOPe 2.06
  
• d1qvfl_ appears in the current release, SCOPe 2.08