Lineage for d1qvfl_ (1qvf L:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407471Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 407472Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 407496Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 407497Protein Ribosomal protein L15e [54194] (1 species)
  7. 407498Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (18 PDB entries)
  8. 407506Domain d1qvfl_: 1qvf L: [96374]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    complexed with cd, cl, k, mg, na

Details for d1qvfl_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfl_ d.12.1.2 (L:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1qvfl_:

Click to download the PDB-style file with coordinates for d1qvfl_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfl_: