SCOPe 2.06: Domain d1qvfj_: 1qvf J:

Lineage for d1qvfj_ (1qvf J:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)
   automatically mapped to Pfam PF00238

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
   Uniprot P22450

8. Domain d1qvfj_: 1qvf J: [96372]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvfj_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (J:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1qvfj_:

Sequence; same for both SEQRES and ATOM records:

>d1qvfj_ b.39.1.1 (J:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1qvfj_:

• d1qvfj_ first appeared in SCOP 1.67
  
• d1qvfj_ appears in SCOPe 2.05
  
• d1qvfj_ appears in SCOPe 2.07
  
• d1qvfj_ appears in the current release, SCOPe 2.08