SCOPe 2.06: Domain d1qvfd_: 1qvf D:

Lineage for d1qvfd_ (1qvf D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (5 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
   Uniprot P14124

8. Domain d1qvfd_: 1qvf D: [96365]
   Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvfd_

PDB Entry: 1qvf, 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1qvfd_:

Sequence, based on SEQRES records:

>d1qvfd_ d.77.1.1 (D:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records):

>d1qvfd_ d.77.1.1 (D:) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

Timeline for d1qvfd_:

• d1qvfd_ first appeared in SCOP 1.67
  
• d1qvfd_ appears in SCOPe 2.05
  
• d1qvfd_ appears in SCOPe 2.07
  
• d1qvfd_ appears in the current release, SCOPe 2.08