Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) |
Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
Species Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries) Uniprot P12735 |
Domain d1qvfc_: 1qvf C: [96364] Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1qvf (more details), 3.1 Å
SCOPe Domain Sequences for d1qvfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qvfc_ c.22.1.1 (C:) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]} mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal aevaer
Timeline for d1qvfc_:
View in 3D Domains from other chains: (mouse over for more information) d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_ |