Lineage for d1qvf1_ (1qvf 1:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099678Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 1099679Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 1099680Protein Ribosomal protein L39e [48664] (1 species)
  7. 1099681Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 1099728Domain d1qvf1_: 1qvf 1: [96359]
    Other proteins in same PDB: d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1qvf1_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1qvf1_:

Sequence, based on SEQRES records: (download)

>d1qvf1_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1qvf1_ a.137.1.1 (1:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOPe Domain Coordinates for d1qvf1_:

Click to download the PDB-style file with coordinates for d1qvf1_.
(The format of our PDB-style files is described here.)

Timeline for d1qvf1_: