Lineage for d1qv9a_ (1qv9 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 405071Fold c.127: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102323] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213456
  4. 405072Superfamily c.127.1: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102324] (1 family) (S)
    the sheet topology is similar to those of the Periplasmic binding protein-like I domains
  5. 405073Family c.127.1.1: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102325] (1 protein)
  6. 405074Protein F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102326] (1 species)
  7. 405075Species Archaeon Methanopyrus kandleri [TaxId:2320] [102327] (1 PDB entry)
  8. 405076Domain d1qv9a_: 1qv9 A: [96356]

Details for d1qv9a_

PDB Entry: 1qv9 (more details), 1.54 Å

PDB Description: Coenzyme F420-dependent methylenetetrahydromethanopterin dehydrogenase (Mtd) from Methanopyrus kandleri: A methanogenic enzyme with an unusual quarternary structure

SCOP Domain Sequences for d1qv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qv9a_ c.127.1.1 (A:) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) {Archaeon Methanopyrus kandleri}
tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe

SCOP Domain Coordinates for d1qv9a_:

Click to download the PDB-style file with coordinates for d1qv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1qv9a_: