SCOP 1.67: Domain d1qewa1: 1qew A:182-275

Lineage for d1qewa1 (1qew A:182-275)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)

8. Domain d1qewa1: 1qew A:182-275 [96341]
   Other proteins in same PDB: d1qewa2, d1qewb_

Details for d1qewa1

PDB Entry: 1qew, 2.2 Å

PDB Description: human class i histocompatibility antigen (hla-a 0201) complex with a nonameric peptide from melanoma-associated antigen 3 (residues 271- 279)

SCOP Domain Sequences for d1qewa1:

Sequence; same for both SEQRES and ATOM records:

>d1qewa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1qewa1:

• d1qewa1 is new in SCOP 1.67
  
• d1qewa1 appears in SCOP 1.69
  
• d1qewa1 appears in the current release, SCOPe 2.08