Lineage for d1qaha_ (1qah A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958621Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (3 species)
    mammalian tumor associated antigen UK114
  7. 2958639Species Norway rat (Rattus norvegicus) [TaxId:10116] [103078] (1 PDB entry)
    Perchloric acid soluble protein
  8. 2958640Domain d1qaha_: 1qah A: [96338]

Details for d1qaha_

PDB Entry: 1qah (more details), 1.8 Å

PDB Description: crystal structure of perchloric acid soluble protein-a translational inhibitor
PDB Compounds: (A:) perchloric acid soluble protein

SCOPe Domain Sequences for d1qaha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qaha_ d.79.1.1 (A:) 14.5 kda translational inhibitor protein, L-PSP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssiirkvistskapaaigaysqavlvdrtiyvsgqigmdpssgqlvpggvaeeakqalkn
lgeilkaagcdftnvvkttvlladindfgtvneiyktyfqgnlparaayqvaalpkgsri
eieaiavqgpft

SCOPe Domain Coordinates for d1qaha_:

Click to download the PDB-style file with coordinates for d1qaha_.
(The format of our PDB-style files is described here.)

Timeline for d1qaha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qahb_