Lineage for d1q9ya2 (1q9y A:376-902)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 517943Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 518007Protein Family B DNA polymerase [56680] (6 species)
  7. 518017Species Bacteriophage RB69 [TaxId:12353] [56681] (8 PDB entries)
  8. 518021Domain d1q9ya2: 1q9y A:376-902 [96337]
    Other proteins in same PDB: d1q9ya1

Details for d1q9ya2

PDB Entry: 1q9y (more details), 2.8 Å

PDB Description: crystal structure of enterobacteria phage rb69 gp43 dna polymerase complexed with 8-oxoguanosine containing dna

SCOP Domain Sequences for d1q9ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9ya2 e.8.1.1 (A:376-902) Family B DNA polymerase {Bacteriophage RB69}
lkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiag
tfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaa
qrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevag
mtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgte
geafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremce
ymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimglet
qksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakyd
vggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgt
eitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfd

SCOP Domain Coordinates for d1q9ya2:

Click to download the PDB-style file with coordinates for d1q9ya2.
(The format of our PDB-style files is described here.)

Timeline for d1q9ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q9ya1