Lineage for d1q9xc1 (1q9x C:1-375)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488414Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 488631Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 488632Protein Exonuclease domain of family B DNA polymerases [53125] (7 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 488642Species Bacteriophage RB69 [TaxId:12353] [53127] (8 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 488656Domain d1q9xc1: 1q9x C:1-375 [96332]
    Other proteins in same PDB: d1q9xa2, d1q9xb2, d1q9xc2, d1q9xd2

Details for d1q9xc1

PDB Entry: 1q9x (more details), 2.69 Å

PDB Description: crystal structure of enterobacteria phage rb69 gp43 dna polymerase complexed with tetrahydrofuran containing dna

SCOP Domain Sequences for d1q9xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9xc1 c.55.3.5 (C:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOP Domain Coordinates for d1q9xc1:

Click to download the PDB-style file with coordinates for d1q9xc1.
(The format of our PDB-style files is described here.)

Timeline for d1q9xc1: