Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins) |
Protein Exonuclease domain of family B DNA polymerases [53125] (7 species) elaborated with additional structures and the N-terminal subdomain |
Species Bacteriophage RB69 [TaxId:12353] [53127] (8 PDB entries) additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold |
Domain d1q9xc1: 1q9x C:1-375 [96332] Other proteins in same PDB: d1q9xa2, d1q9xb2, d1q9xc2, d1q9xd2 |
PDB Entry: 1q9x (more details), 2.69 Å
SCOP Domain Sequences for d1q9xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9xc1 c.55.3.5 (C:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69} mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs piktwdaiifnslke
Timeline for d1q9xc1: