SCOP 1.73: Domain d1q9xb1: 1q9x B:1-375

Lineage for d1q9xb1 (1q9x B:1-375)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Bacteriophage RB69 [TaxId:12353] [53127] (10 PDB entries)
   additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold

8. Domain d1q9xb1: 1q9x B:1-375 [96330]
   Other proteins in same PDB: d1q9xa2, d1q9xb2, d1q9xc2, d1q9xd2

Details for d1q9xb1

PDB Entry: 1q9x, 2.69 Å

PDB Description: crystal structure of enterobacteria phage rb69 gp43 dna polymerase complexed with tetrahydrofuran containing dna

PDB Compounds: (B:) DNA polymerase

SCOP Domain Sequences for d1q9xb1:

Sequence; same for both SEQRES and ATOM records:

>d1q9xb1 c.55.3.5 (B:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

Timeline for d1q9xb1:

• d1q9xb1 first appeared in SCOP 1.67
  
• d1q9xb1 appears in SCOP 1.71
  
• d1q9xb1 appears in SCOP 1.75
  
• d1q9xb1 appears in the current release, SCOPe 2.08