![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
![]() | Species Bacteriophage RB69 [TaxId:12353] [53127] (10 PDB entries) additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold |
![]() | Domain d1q9xb1: 1q9x B:1-375 [96330] Other proteins in same PDB: d1q9xa2, d1q9xb2, d1q9xc2, d1q9xd2 |
PDB Entry: 1q9x (more details), 2.69 Å
SCOP Domain Sequences for d1q9xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9xb1 c.55.3.5 (B:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]} mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs piktwdaiifnslke
Timeline for d1q9xb1: