Lineage for d1q9xa2 (1q9x A:376-903)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622071Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2622168Protein Family B DNA polymerase [56680] (7 species)
  7. 2622169Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 2622247Domain d1q9xa2: 1q9x A:376-903 [96329]
    Other proteins in same PDB: d1q9xa1, d1q9xb1, d1q9xc1, d1q9xd1
    protein/DNA complex; complexed with 3dr, ca, dgp, doc

Details for d1q9xa2

PDB Entry: 1q9x (more details), 2.69 Å

PDB Description: crystal structure of enterobacteria phage rb69 gp43 dna polymerase complexed with tetrahydrofuran containing dna
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1q9xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9xa2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOPe Domain Coordinates for d1q9xa2:

Click to download the PDB-style file with coordinates for d1q9xa2.
(The format of our PDB-style files is described here.)

Timeline for d1q9xa2: