SCOP 1.71: Domain d1q9wb2: 1q9w B:112-213

Lineage for d1q9wb2 (1q9w B:112-213)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1q9wb2: 1q9w B:112-213 [96323]
   Other proteins in same PDB: d1q9wa1, d1q9wa2, d1q9wb1, d1q9wc1, d1q9wc2, d1q9wd1

Details for d1q9wb2

PDB Entry: 1q9w, 1.75 Å

PDB Description: s45-18 fab pentasaccharide bisphosphate complex

SCOP Domain Sequences for d1q9wb2:

Sequence; same for both SEQRES and ATOM records:

>d1q9wb2 b.1.1.2 (B:112-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1q9wb2:

• d1q9wb2 first appeared in SCOP 1.67
  
• d1q9wb2 appears in SCOP 1.69
  
• d1q9wb2 appears in SCOP 1.73
  
• d1q9wb2 appears in the current release, SCOPe 2.08