Lineage for d1q9wb1 (1q9w B:1-111)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546690Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)
  8. 546699Domain d1q9wb1: 1q9w B:1-111 [96322]
    Other proteins in same PDB: d1q9wa1, d1q9wa2, d1q9wb2, d1q9wc1, d1q9wc2, d1q9wd2

Details for d1q9wb1

PDB Entry: 1q9w (more details), 1.75 Å

PDB Description: s45-18 fab pentasaccharide bisphosphate complex

SCOP Domain Sequences for d1q9wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9wb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evilvesggglvqpggslrlscstsgftftdyymswvrqppgkalewlgfirnkpkgytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycvrdiysfgsrdgmdywgqgtsv
tvss

SCOP Domain Coordinates for d1q9wb1:

Click to download the PDB-style file with coordinates for d1q9wb1.
(The format of our PDB-style files is described here.)

Timeline for d1q9wb1: