Lineage for d1q9wa2 (1q9w A:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761919Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1761943Domain d1q9wa2: 1q9w A:108-213 [96321]
    Other proteins in same PDB: d1q9wa1, d1q9wb1, d1q9wb2, d1q9wc1, d1q9wd1, d1q9wd2
    part of Fab s45-18
    complexed with mg

Details for d1q9wa2

PDB Entry: 1q9w (more details), 1.75 Å

PDB Description: S45-18 Fab pentasaccharide bisphosphate complex
PDB Compounds: (A:) S45-18 Fab (IgG1k) light chain

SCOPe Domain Sequences for d1q9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9wa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1q9wa2:

Click to download the PDB-style file with coordinates for d1q9wa2.
(The format of our PDB-style files is described here.)

Timeline for d1q9wa2: