SCOP 1.67: Domain d1q9va1: 1q9v A:1-107

Lineage for d1q9va1 (1q9v A:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (34 PDB entries)

8. Domain d1q9va1: 1q9v A:1-107 [96316]
   Other proteins in same PDB: d1q9va2, d1q9vb1, d1q9vb2
   part of Fab s25-2
   complexed with kdo, mg, zn

Details for d1q9va1

PDB Entry: 1q9v, 1.73 Å

PDB Description: S25-2- Kdo monosaccharide complex

SCOP Domain Sequences for d1q9va1:

Sequence; same for both SEQRES and ATOM records:

>d1q9va1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d1q9va1:

• d1q9va1 is new in SCOP 1.67
  
• d1q9va1 appears in SCOP 1.69
  
• d1q9va1 last appears in SCOP 1.75