Lineage for d1q9ub_ (1q9u B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582784Superfamily d.129.7: TT1751-like [103247] (1 family) (S)
    contains a single copy of this fold decorated with additional structures; forms dimer
  5. 2582785Family d.129.7.1: TT1751-like [103248] (2 proteins)
    Pfam PF03625; DUF302
  6. 2582790Protein Unnamed hypothetical protein [103249] (1 species)
  7. 2582791Species Bacillus stearothermophilus [TaxId:1422] [103250] (1 PDB entry)
  8. 2582793Domain d1q9ub_: 1q9u B: [96315]
    structural genomics; MCSG target APC35924
    complexed with zn

Details for d1q9ub_

PDB Entry: 1q9u (more details), 1.8 Å

PDB Description: crystal structure of uncharacterized conserved protein duf302 from bacillus stearothermophilus
PDB Compounds: (B:) Uncharacterized protein APC35924

SCOPe Domain Sequences for d1q9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9ub_ d.129.7.1 (B:) Unnamed hypothetical protein {Bacillus stearothermophilus [TaxId: 1422]}
amfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnp
qeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrl
aacldrcr

SCOPe Domain Coordinates for d1q9ub_:

Click to download the PDB-style file with coordinates for d1q9ub_.
(The format of our PDB-style files is described here.)

Timeline for d1q9ub_: