Lineage for d1q9ub_ (1q9u B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 511174Superfamily d.129.7: TT1751-like [103247] (1 family) (S)
    contains a single copy of this fold decorated with additional structures; forms dimer
  5. 511175Family d.129.7.1: TT1751-like [103248] (2 proteins)
    Pfam 03625; domain of unknown function DUF302
  6. 511180Protein Unnamed hypothetical protein [103249] (1 species)
  7. 511181Species Bacillus stearothermophilus [TaxId:1422] [103250] (1 PDB entry)
  8. 511183Domain d1q9ub_: 1q9u B: [96315]
    structural genomics; MCSG target APC35924

Details for d1q9ub_

PDB Entry: 1q9u (more details), 1.8 Å

PDB Description: crystal structure of uncharacterized conserved protein duf302 from bacillus stearothermophilus

SCOP Domain Sequences for d1q9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9ub_ d.129.7.1 (B:) Unnamed hypothetical protein {Bacillus stearothermophilus}
amfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnp
qeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrl
aacldrcr

SCOP Domain Coordinates for d1q9ub_:

Click to download the PDB-style file with coordinates for d1q9ub_.
(The format of our PDB-style files is described here.)

Timeline for d1q9ub_: