Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.129: TBP-like [55944] (7 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.7: TT1751-like [103247] (1 family) contains a single copy of this fold decorated with additional structures; forms dimer |
Family d.129.7.1: TT1751-like [103248] (1 protein) Pfam 03625; domain of unknown function DUF302 |
Protein Unnamed hypothetical protein [103249] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [103250] (1 PDB entry) |
Domain d1q9ub_: 1q9u B: [96315] structural genomics; MCSG target APC35924 complexed with zn |
PDB Entry: 1q9u (more details), 1.8 Å
SCOP Domain Sequences for d1q9ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9ub_ d.129.7.1 (B:) Unnamed hypothetical protein {Bacillus stearothermophilus} amfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnp qeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrl aacldrcr
Timeline for d1q9ub_: