SCOP 1.67: Domain d1q9ub_: 1q9u B:

Lineage for d1q9ub_ (1q9u B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.129: TBP-like [55944] (7 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.7: TT1751-like [103247] (1 family)
   contains a single copy of this fold decorated with additional structures; forms dimer

5. Family d.129.7.1: TT1751-like [103248] (1 protein)
   Pfam 03625; domain of unknown function DUF302

6. Protein Unnamed hypothetical protein [103249] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [103250] (1 PDB entry)

8. Domain d1q9ub_: 1q9u B: [96315]
   structural genomics; MCSG target APC35924
   complexed with zn

Details for d1q9ub_

PDB Entry: 1q9u, 1.8 Å

PDB Description: crystal structure of uncharacterized conserved protein duf302 from bacillus stearothermophilus

SCOP Domain Sequences for d1q9ub_:

Sequence; same for both SEQRES and ATOM records:

>d1q9ub_ d.129.7.1 (B:) Unnamed hypothetical protein {Bacillus stearothermophilus}
amfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnp
qeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrl
aacldrcr

Timeline for d1q9ub_:

• d1q9ub_ is new in SCOP 1.67
  
• d1q9ub_ appears in SCOP 1.69
  
• d1q9ub_ appears in the current release, SCOPe 2.08