SCOP 1.71: Domain d1q9ua_: 1q9u A:

Lineage for d1q9ua_ (1q9u A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.129: TBP-like [55944] (9 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.7: TT1751-like [103247] (1 family)
   contains a single copy of this fold decorated with additional structures; forms dimer

5. Family d.129.7.1: TT1751-like [103248] (2 proteins)
   Pfam 03625; DUF302

6. Protein Unnamed hypothetical protein [103249] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [103250] (1 PDB entry)

8. Domain d1q9ua_: 1q9u A: [96314]

Details for d1q9ua_

PDB Entry: 1q9u, 1.8 Å

PDB Description: crystal structure of uncharacterized conserved protein duf302 from bacillus stearothermophilus

SCOP Domain Sequences for d1q9ua_:

Sequence; same for both SEQRES and ATOM records:

>d1q9ua_ d.129.7.1 (A:) Unnamed hypothetical protein {Bacillus stearothermophilus}
amfhytvdvstgmnetierleeslkqegfgvlwqfsvteklqekgldfstpmvilevcnp
qeaarvlnenllvgyflpcklvvyqengttkigmpkptmlvgmmndpalkeiaadiekrl
aacldrcr

Timeline for d1q9ua_:

• d1q9ua_ first appeared in SCOP 1.67
  
• d1q9ua_ appears in SCOP 1.69
  
• d1q9ua_ appears in SCOP 1.73
  
• d1q9ua_ appears in the current release, SCOPe 2.08