Lineage for d1q9sa_ (1q9s A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669846Superfamily b.43.5: Riboflavin kinase-like [82114] (1 family) (S)
  5. 669847Family b.43.5.1: Riboflavin kinase-like [82115] (2 proteins)
  6. 669848Protein Riboflavin kinase [82116] (2 species)
  7. 669857Species Human (Homo sapiens) [TaxId:9606] [89338] (4 PDB entries)
    encoded by FLJ11149
  8. 669861Domain d1q9sa_: 1q9s A: [96309]
    complexed with adp, fmn, mg

Details for d1q9sa_

PDB Entry: 1q9s (more details), 2.42 Å

PDB Description: Crystal structure of riboflavin kinase with ternary product complex
PDB Compounds: (A:) hypothetical protein FLJ11149

SCOP Domain Sequences for d1q9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9sa_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens) [TaxId: 9606]}
imrhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvh
kmvvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisai
qgdieeakkrlelpeylkikednffqvsk

SCOP Domain Coordinates for d1q9sa_:

Click to download the PDB-style file with coordinates for d1q9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1q9sa_: