SCOP 1.69: Domain d1q9rb1: 1q9r B:1-111

Lineage for d1q9rb1 (1q9r B:1-111)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)

8. Domain d1q9rb1: 1q9r B:1-111 [96307]
   Other proteins in same PDB: d1q9ra1, d1q9ra2, d1q9rb2
   part of Fab s25-2

Details for d1q9rb1

PDB Entry: 1q9r, 1.45 Å

PDB Description: S25-2- a(2-8)Kdo disaccharide complex

SCOP Domain Sequences for d1q9rb1:

Sequence; same for both SEQRES and ATOM records:

>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
sa

Timeline for d1q9rb1:

• d1q9rb1 first appeared in SCOP 1.67
  
• d1q9rb1 appears in SCOP 1.71
  
• d1q9rb1 last appears in SCOP 1.75