Lineage for d1q9qb2 (1q9q B:112-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365151Domain d1q9qb2: 1q9q B:112-211 [96304]
    Other proteins in same PDB: d1q9qa1, d1q9qa2, d1q9qb1
    part of Fab s25-2
    complexed with kda, kdo, mg, zn

Details for d1q9qb2

PDB Entry: 1q9q (more details), 1.49 Å

PDB Description: S25-2- a(2-8)-a(2-4)Kdo trisaccharide complex

SCOP Domain Sequences for d1q9qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9qb2 b.1.1.2 (B:112-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1q9qb2:

Click to download the PDB-style file with coordinates for d1q9qb2.
(The format of our PDB-style files is described here.)

Timeline for d1q9qb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q9qb1