Lineage for d1q9oa1 (1q9o A:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783027Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (36 PDB entries)
  8. 783037Domain d1q9oa1: 1q9o A:1-107 [96292]
    Other proteins in same PDB: d1q9oa2, d1q9ob1, d1q9ob2, d1q9oc2, d1q9od1, d1q9od2
    part of Fab s45-18

Details for d1q9oa1

PDB Entry: 1q9o (more details), 1.79 Å

PDB Description: S45-18 Fab Unliganded
PDB Compounds: (A:) S45-2 Fab (IgG1k) light chain

SCOP Domain Sequences for d1q9oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9oa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqfpsslavsagekvtmsckssqsllnsrtrksylawyqqkpgqfpklliywaatr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgggtkleikr

SCOP Domain Coordinates for d1q9oa1:

Click to download the PDB-style file with coordinates for d1q9oa1.
(The format of our PDB-style files is described here.)

Timeline for d1q9oa1: