Lineage for d1q9lc2 (1q9l C:108-213)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365904Domain d1q9lc2: 1q9l C:108-213 [96285]
    Other proteins in same PDB: d1q9la1, d1q9lb1, d1q9lb2, d1q9lc1, d1q9ld1, d1q9ld2
    part of Fab s25-2
    complexed with mg, zn

Details for d1q9lc2

PDB Entry: 1q9l (more details), 2.28 Å

PDB Description: S25-2 Fab Unliganded 2

SCOP Domain Sequences for d1q9lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9lc2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1q9lc2:

Click to download the PDB-style file with coordinates for d1q9lc2.
(The format of our PDB-style files is described here.)

Timeline for d1q9lc2: