SCOPe 2.05: Domain d1q9ec_: 1q9e C:

Lineage for d1q9ec_ (1q9e C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1q9ec_: 1q9e C: [96271]
   complexed with trs

Details for d1q9ec_

PDB Entry: 1q9e, 1.7 Å

PDB Description: rnase t1 variant with adenine specificity

PDB Compounds: (C:) Guanyl-specific ribonuclease T1 precursor

SCOPe Domain Sequences for d1q9ec_:

Sequence; same for both SEQRES and ATOM records:

>d1q9ec_ d.1.1.4 (C:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphefrnwngfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1q9ec_:

• d1q9ec_ first appeared in SCOP 1.67
  
• d1q9ec_ appears in SCOPe 2.04
  
• d1q9ec_ appears in SCOPe 2.06
  
• d1q9ec_ appears in the current release, SCOPe 2.08