SCOP 1.69: Domain d1q9ci_: 1q9c I:

Lineage for d1q9ci_ (1q9c I:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (11 proteins)

6. Protein Histone domain of Son of sevenless protein [101107] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry)

8. Domain d1q9ci_: 1q9c I: [96266]

Details for d1q9ci_

PDB Entry: 1q9c, 3.21 Å

PDB Description: Crystal Structure of the Histone domain of Son of Sevenless

SCOP Domain Sequences for d1q9ci_:

Sequence; same for both SEQRES and ATOM records:

>d1q9ci_ a.22.1.3 (I:) Histone domain of Son of sevenless protein {Human (Homo sapiens)}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi

Timeline for d1q9ci_:

• d1q9ci_ first appeared in SCOP 1.67
  
• d1q9ci_ appears in SCOP 1.71
  
• d1q9ci_ appears in the current release, SCOPe 2.08