Lineage for d1q9cf_ (1q9c F:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353304Family a.22.1.3: TBP-associated factors, TAFs [47134] (11 proteins)
  6. 353305Protein Histone domain of Son of sevenless protein [101107] (1 species)
  7. 353306Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry)
  8. 353312Domain d1q9cf_: 1q9c F: [96263]

Details for d1q9cf_

PDB Entry: 1q9c (more details), 3.21 Å

PDB Description: Crystal Structure of the Histone domain of Son of Sevenless

SCOP Domain Sequences for d1q9cf_:

Sequence, based on SEQRES records: (download)

>d1q9cf_ a.22.1.3 (F:) Histone domain of Son of sevenless protein {Human (Homo sapiens)}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi

Sequence, based on observed residues (ATOM records): (download)

>d1q9cf_ a.22.1.3 (F:) Histone domain of Son of sevenless protein {Human (Homo sapiens)}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrplslpvekihpllkevlgykidhqvsvy
ivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi

SCOP Domain Coordinates for d1q9cf_:

Click to download the PDB-style file with coordinates for d1q9cf_.
(The format of our PDB-style files is described here.)

Timeline for d1q9cf_: