Lineage for d1q9cf_ (1q9c F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699146Protein Histone domain of Son of sevenless protein [101107] (1 species)
  7. 2699147Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry)
  8. 2699153Domain d1q9cf_: 1q9c F: [96263]
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d1q9cf_

PDB Entry: 1q9c (more details), 3.21 Å

PDB Description: Crystal Structure of the Histone domain of Son of Sevenless
PDB Compounds: (F:) Son of sevenless protein

SCOPe Domain Sequences for d1q9cf_:

Sequence, based on SEQRES records: (download)

>d1q9cf_ a.22.1.3 (F:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi

Sequence, based on observed residues (ATOM records): (download)

>d1q9cf_ a.22.1.3 (F:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrplslpvekihpllkevlgykidhqvsvy
ivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi

SCOPe Domain Coordinates for d1q9cf_:

Click to download the PDB-style file with coordinates for d1q9cf_.
(The format of our PDB-style files is described here.)

Timeline for d1q9cf_: