Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
Protein Histone domain of Son of sevenless protein [101107] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry) |
Domain d1q9cd_: 1q9c D: [96261] |
PDB Entry: 1q9c (more details), 3.21 Å
SCOPe Domain Sequences for d1q9cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9cd_ a.22.1.3 (D:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi
Timeline for d1q9cd_: