Lineage for d1q9cd_ (1q9c D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440192Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 440193Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 440429Family a.22.1.3: TBP-associated factors, TAFs [47134] (11 proteins)
  6. 440430Protein Histone domain of Son of sevenless protein [101107] (1 species)
  7. 440431Species Human (Homo sapiens) [TaxId:9606] [101108] (1 PDB entry)
  8. 440435Domain d1q9cd_: 1q9c D: [96261]

Details for d1q9cd_

PDB Entry: 1q9c (more details), 3.21 Å

PDB Description: Crystal Structure of the Histone domain of Son of Sevenless

SCOP Domain Sequences for d1q9cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9cd_ a.22.1.3 (D:) Histone domain of Son of sevenless protein {Human (Homo sapiens)}
lpyeffseenapkwrgllvpalkkvqgqvhptlesnddalqyveelilqllnmlcqaqpr
sasdveervqksfphpidkwaiadaqsaiekrkrrnplslpvekihpllkevlgykidhq
vsvyivavleyisadilklagnyvrnirhyeitkqdikvamcadkvlmdmfhqdvedi

SCOP Domain Coordinates for d1q9cd_:

Click to download the PDB-style file with coordinates for d1q9cd_.
(The format of our PDB-style files is described here.)

Timeline for d1q9cd_: