Lineage for d1q99b_ (1q99 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512479Protein Sky1p [56148] (1 species)
    CMGC group; Clk subfamily; serine/threonine kinase
  7. 512480Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries)
  8. 512485Domain d1q99b_: 1q99 B: [96256]

Details for d1q99b_

PDB Entry: 1q99 (more details), 2.11 Å

PDB Description: crystal structure of the saccharomyces cerevisiae sr protein kinsae, sky1p, complexed with the non-hydrolyzable atp analogue, amp-pnp

SCOP Domain Sequences for d1q99b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q99b_ d.144.1.7 (B:) Sky1p {Baker's yeast (Saccharomyces cerevisiae)}
ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed
eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye
hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn
acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt
kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk
deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf
eevr

SCOP Domain Coordinates for d1q99b_:

Click to download the PDB-style file with coordinates for d1q99b_.
(The format of our PDB-style files is described here.)

Timeline for d1q99b_: