SCOPe 2.06: Domain d1q98b_: 1q98 B:

Lineage for d1q98b_ (1q98 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thiol peroxidase Tpx [102452] (4 species)

7. Species Haemophilus influenzae [TaxId:727] [102454] (1 PDB entry)
   HI0751

8. Domain d1q98b_: 1q98 B: [96254]
   structural genomics; NYSGRC target T1429

Details for d1q98b_

PDB Entry: 1q98, 1.9 Å

PDB Description: structure of a thiol peroxidase from haemophilus influenzae rd

PDB Compounds: (B:) Thiol Peroxidase

SCOPe Domain Sequences for d1q98b_:

Sequence; same for both SEQRES and ATOM records:

>d1q98b_ c.47.1.10 (B:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]}
tvtlagnpievgghfpqvgeivenfilvgndladvalndfaskrkvlnifpsidtgvcat
svrkfnqqaaklsntivlcisadlpfaqarfcgaegienaktvstfrnhalhsqlgvdiq
tgplagltsravivldeqnnvlhsqlveeikeepnyeaalavla

Timeline for d1q98b_:

• d1q98b_ first appeared in SCOP 1.67
  
• d1q98b_ appears in SCOPe 2.05
  
• d1q98b_ appears in SCOPe 2.07
  
• d1q98b_ appears in the current release, SCOPe 2.08