![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Sky1p [56148] (1 species) CMGC group; Clk subfamily; serine/threonine kinase |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries) |
![]() | Domain d1q97a_: 1q97 A: [96251] |
PDB Entry: 1q97 (more details), 2.3 Å
SCOP Domain Sequences for d1q97a_:
Sequence, based on SEQRES records: (download)
>d1q97a_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} yhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkd ddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskde akeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfee vr
>d1q97a_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} yhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfkdddhiaqiie llgelpsyllrngkytrtffnsllrnisklkfwpledvltekykfskdeakeisdflspm lqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr
Timeline for d1q97a_: