SCOPe 2.05: Domain d1q92a_: 1q92 A:

Lineage for d1q92a_ (1q92 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
   automatically mapped to Pfam PF06941

6. Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82384] (4 PDB entries)

8. Domain d1q92a_: 1q92 A: [96250]
   complexed with drm, gol, mg

Details for d1q92a_

PDB Entry: 1q92, 1.4 Å

PDB Description: Crystal structure of human mitochondrial deoxyribonucleotidase in complex with the inhibitor PMcP-U

PDB Compounds: (A:) 5(3)-deoxyribonucleotidase

SCOPe Domain Sequences for d1q92a_:

Sequence; same for both SEQRES and ATOM records:

>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}
gralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglseka
isiwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfg
pdfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlh
swaddwkaildskrp

Timeline for d1q92a_:

• d1q92a_ first appeared in SCOP 1.67
  
• d1q92a_ appears in SCOPe 2.04
  
• d1q92a_ appears in SCOPe 2.06
  
• d1q92a_ appears in the current release, SCOPe 2.08