| Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
| Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.27: PetN subunit of the cytochrome b6f complex [103451] (1 family) ![]() |
| Family f.23.27.1: PetN subunit of the cytochrome b6f complex [103452] (1 protein) |
| Protein PetN subunit of the cytochrome b6f complex [103453] (2 species) |
| Species Chlamydomonas reinhardtii [TaxId:3055] [103455] (1 PDB entry) |
| Domain d1q90n_: 1q90 N: [96247] Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90r_ complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant |
PDB Entry: 1q90 (more details), 3.1 Å
SCOP Domain Sequences for d1q90n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90n_ f.23.27.1 (N:) PetN subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii}
gepaivqigwaatcvmfsfslslvvwgrsgl
Timeline for d1q90n_: