Lineage for d1q90n_ (1q90 N:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520305Superfamily f.23.27: PetN subunit of the cytochrome b6f complex [103451] (1 family) (S)
  5. 520306Family f.23.27.1: PetN subunit of the cytochrome b6f complex [103452] (1 protein)
  6. 520307Protein PetN subunit of the cytochrome b6f complex [103453] (2 species)
  7. 520308Species Chlamydomonas reinhardtii [TaxId:3055] [103455] (1 PDB entry)
  8. 520309Domain d1q90n_: 1q90 N: [96247]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90r_

Details for d1q90n_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90n_ f.23.27.1 (N:) PetN subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii}
gepaivqigwaatcvmfsfslslvvwgrsgl

SCOP Domain Coordinates for d1q90n_:

Click to download the PDB-style file with coordinates for d1q90n_.
(The format of our PDB-style files is described here.)

Timeline for d1q90n_: