Lineage for d1q90g_ (1q90 G:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 746069Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family) (S)
  5. 746070Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (1 protein)
  6. 746071Protein PetG subunit of the cytochrome b6f complex [103448] (2 species)
  7. 746072Species Chlamydomonas reinhardtii [TaxId:3055] [103450] (1 PDB entry)
  8. 746073Domain d1q90g_: 1q90 G: [96244]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant

Details for d1q90g_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
PDB Compounds: (G:) Cytochrome b6f complex subunit petG

SCOP Domain Sequences for d1q90g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90g_ f.23.26.1 (G:) PetG subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii [TaxId: 3055]}
mvepllcgivlglvpvtiaglfvtaylqyl

SCOP Domain Coordinates for d1q90g_:

Click to download the PDB-style file with coordinates for d1q90g_.
(The format of our PDB-style files is described here.)

Timeline for d1q90g_: