Lineage for d1q90d_ (1q90 D:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633244Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2633245Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2633246Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2633293Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 2633294Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103497] (1 PDB entry)
  8. 2633295Domain d1q90d_: 1q90 D: [96243]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cla, fes, hem, lfa, lmg, sqd, tds

Details for d1q90d_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
PDB Compounds: (D:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d1q90d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90d_ f.32.1.1 (D:) Subunit IV of the cytochrome b6f complex {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkkpdlsdpvlkaklakgmghntygepawpndllymfpvvilgtfacviglsvldpaamg
epanpfatpleilpewyfypvfqilrvvpnkllgvllmaavpaglitvpfiesinkfqnp
yrrpiatilfllgtlvavwlgigstfpidisltlgl

SCOPe Domain Coordinates for d1q90d_:

Click to download the PDB-style file with coordinates for d1q90d_.
(The format of our PDB-style files is described here.)

Timeline for d1q90d_: