Lineage for d1q90c_ (1q90 C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461110Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 461111Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 461112Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
  6. 461124Protein ISP subunit from the cytochrome b6f complex, soluble domain [101665] (2 species)
  7. 461125Species Chlamydomonas reinhardtii [TaxId:3055] [101667] (1 PDB entry)
  8. 461126Domain d1q90c_: 1q90 C: [96242]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_

Details for d1q90c_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90c_:

Sequence, based on SEQRES records: (download)

>d1q90c_ b.33.1.1 (C:) ISP subunit from the cytochrome b6f complex, soluble domain {Chlamydomonas reinhardtii}
qaakdalgndikagewlkthlagdrslsqglkgdptylivtadstiekyglnavcthlgc
vvpwvaaenkfkcpchgsqynaegkvvrgpaplslalahcdvaesglvtfstwtetdfrt
glepwwa

Sequence, based on observed residues (ATOM records): (download)

>d1q90c_ b.33.1.1 (C:) ISP subunit from the cytochrome b6f complex, soluble domain {Chlamydomonas reinhardtii}
qaakdalgndikagewlkthlagdrslsqglkgdptylivtadstiekyglnavcthlgc
vvpwvaaenkfkcpchgsqynaegkvvrgpaplslalahcdvaeglvtfstwtetdfrtg
lepwwa

SCOP Domain Coordinates for d1q90c_:

Click to download the PDB-style file with coordinates for d1q90c_.
(The format of our PDB-style files is described here.)

Timeline for d1q90c_: