Lineage for d1q90b_ (1q90 B:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519804Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 519805Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 519811Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 519812Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)
  7. 519813Species Chlamydomonas reinhardtii [TaxId:3055] [103500] (1 PDB entry)
  8. 519814Domain d1q90b_: 1q90 B: [96241]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_

Details for d1q90b_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90b_ f.21.1.2 (B:) Cytochrome b6 subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii}
vydwfeerleiqaiadditskyvpphvnifyciggitftcflvqvatgfamtfyyrptva
eafasvqyimtdvnfgwlirsihrwsasmmvlmmvlhvfrvyltggfkrpreltwvtgvi
mavctvsfgvtgyslpwdqvgywavkivtgvpdaipgvggfivellrggvgvgqatltrf
yslhtfvlplltavfmlmhflmirkqgisgpl

SCOP Domain Coordinates for d1q90b_:

Click to download the PDB-style file with coordinates for d1q90b_.
(The format of our PDB-style files is described here.)

Timeline for d1q90b_: