| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) ![]() |
| Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein) |
| Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species) |
| Species Chlamydomonas reinhardtii [TaxId:3055] [103435] (1 PDB entry) |
| Domain d1q90a3: 1q90 A:248-292 [96240] Other proteins in same PDB: d1q90a1, d1q90a2, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_ complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant |
PDB Entry: 1q90 (more details), 3.1 Å
SCOP Domain Sequences for d1q90a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90a3 f.23.23.1 (A:248-292) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]}
npariqgllvffsfvlltqvllvlkkkqfekvqlaemnfhhhhhh
Timeline for d1q90a3: