Lineage for d1q90a3 (1q90 A:248-292)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887660Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) (S)
  5. 887661Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein)
  6. 887662Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species)
  7. 887663Species Chlamydomonas reinhardtii [TaxId:3055] [103435] (1 PDB entry)
  8. 887664Domain d1q90a3: 1q90 A:248-292 [96240]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant

Details for d1q90a3

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
PDB Compounds: (A:) Apocytochrome f

SCOP Domain Sequences for d1q90a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90a3 f.23.23.1 (A:248-292) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]}
npariqgllvffsfvlltqvllvlkkkqfekvqlaemnfhhhhhh

SCOP Domain Coordinates for d1q90a3:

Click to download the PDB-style file with coordinates for d1q90a3.
(The format of our PDB-style files is described here.)

Timeline for d1q90a3: