Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Sky1p [56148] (1 species) CMGC group; Clk subfamily; serine/threonine kinase |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries) |
Domain d1q8zb_: 1q8z B: [96237] complexed with edo, moh, so4 |
PDB Entry: 1q8z (more details), 2.35 Å
SCOPe Domain Sequences for d1q8zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q8zb_ d.144.1.7 (B:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf eevr
Timeline for d1q8zb_: