Lineage for d1q8zb_ (1q8z B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419639Protein Sky1p [56148] (1 species)
    CMGC group; Clk subfamily; serine/threonine kinase
  7. 419640Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries)
  8. 419647Domain d1q8zb_: 1q8z B: [96237]
    complexed with edo, moh, so4

Details for d1q8zb_

PDB Entry: 1q8z (more details), 2.35 Å

PDB Description: the apoenzyme structure of the yeast sr protein kinase, sky1p

SCOP Domain Sequences for d1q8zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8zb_ d.144.1.7 (B:) Sky1p {Baker's yeast (Saccharomyces cerevisiae)}
ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed
eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye
hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn
acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt
kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk
deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf
eevr

SCOP Domain Coordinates for d1q8zb_:

Click to download the PDB-style file with coordinates for d1q8zb_.
(The format of our PDB-style files is described here.)

Timeline for d1q8zb_: