Lineage for d1q8wa_ (1q8w A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512073Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 512076Species Cow (Bos taurus) [TaxId:9913] [56118] (12 PDB entries)
  8. 512082Domain d1q8wa_: 1q8w A: [96233]
    complexed with peptide inhibitor, chain B

Details for d1q8wa_

PDB Entry: 1q8w (more details), 2.2 Å

PDB Description: The Catalytic Subunit of cAMP-dependent Protein Kinase in Complex with Rho-kinase Inhibitor Fasudil (HA-1077)

SCOP Domain Sequences for d1q8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8wa_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus)}
svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki
ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlr
rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg
rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg
kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap
fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOP Domain Coordinates for d1q8wa_:

Click to download the PDB-style file with coordinates for d1q8wa_.
(The format of our PDB-style files is described here.)

Timeline for d1q8wa_: