Lineage for d1q8ua_ (1q8u A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218518Protein cAMP-dependent PK, catalytic subunit [56116] (5 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2218521Species Cow (Bos taurus) [TaxId:9913] [56118] (40 PDB entries)
    Uniprot P00517
  8. 2218524Domain d1q8ua_: 1q8u A: [96230]
    complexed with peptide inhibitor, chain B
    complexed with h52, mg8

Details for d1q8ua_

PDB Entry: 1q8u (more details), 1.9 Å

PDB Description: The Catalytic Subunit of cAMP-dependent Protein Kinase in Complex with Rho-kinase Inhibitor H-1152P
PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d1q8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ua_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d1q8ua_:

Click to download the PDB-style file with coordinates for d1q8ua_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ua_: