SCOP 1.75: Domain d1q8ua_: 1q8u A:

Lineage for d1q8ua_ (1q8u A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (32 PDB entries)
   Uniprot P00517

8. Domain d1q8ua_: 1q8u A: [96230]
   complexed with peptide inhibitor, chain B
   complexed with h52, mg8

Details for d1q8ua_

PDB Entry: 1q8u, 1.9 Å

PDB Description: The Catalytic Subunit of cAMP-dependent Protein Kinase in Complex with Rho-kinase Inhibitor H-1152P

PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d1q8ua_:

Sequence; same for both SEQRES and ATOM records:

>d1q8ua_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
kkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetg
nhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpgg
emfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfg
fakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqi
yekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiy
qrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d1q8ua_:

• d1q8ua_ first appeared in SCOP 1.67
  
• d1q8ua_ appears in SCOP 1.73
  
• d1q8ua_ appears in SCOPe 2.01
  
• d1q8ua_ appears in the current release, SCOPe 2.08